Structure of PDB 7wf7 Chain A

Receptor sequence
>7wf7A (length=271) Species: 9606 (Homo sapiens) [Search protein sequence]
DIIVRHYNYTGKLNKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMY
YFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSAS
VWSLLAIAIERYITMLKMKLHFRLFLLISACWVISLILGGLPIMGWNCSA
LSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTF
LALLKTVIIVLSVFIACWAPLFILLLLDVKVKTCDILFRAEYFLVLAVLN
SGTNPIIYTLTNKEMRRAFIR
3D structure
PDB7wf7 Structural basis of sphingosine-1-phosphate receptor 1 activation and biased agonism.
ChainA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 S1P A K34 R120 E121 G122 F125 L297 K12 R89 E90 G91 F94 L244 BindingDB: IC50=1.40nM,EC50=4.3nM
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0038036 sphingosine-1-phosphate receptor activity
GO:0046625 sphingolipid binding
Biological Process
GO:0001525 angiogenesis
GO:0001955 blood vessel maturation
GO:0003245 cardiac muscle tissue growth involved in heart morphogenesis
GO:0003376 sphingosine-1-phosphate receptor signaling pathway
GO:0006935 chemotaxis
GO:0007155 cell adhesion
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007420 brain development
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0016477 cell migration
GO:0019222 regulation of metabolic process
GO:0019226 transmission of nerve impulse
GO:0030032 lamellipodium assembly
GO:0030036 actin cytoskeleton organization
GO:0030155 regulation of cell adhesion
GO:0030182 neuron differentiation
GO:0030335 positive regulation of cell migration
GO:0030500 regulation of bone mineralization
GO:0030595 leukocyte chemotaxis
GO:0045124 regulation of bone resorption
GO:0045446 endothelial cell differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0050927 positive regulation of positive chemotaxis
GO:0051497 negative regulation of stress fiber assembly
GO:0061384 heart trabecula morphogenesis
GO:0072678 T cell migration
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0045121 membrane raft
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wf7, PDBe:7wf7, PDBj:7wf7
PDBsum7wf7
PubMed34937912
UniProtP21453|S1PR1_HUMAN Sphingosine 1-phosphate receptor 1 (Gene Name=S1PR1)

[Back to BioLiP]