Structure of PDB 7wb3 Chain A

Receptor sequence

>7wb3A (length=203) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence]

IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYF
GEFGKRGVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMK
EKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVP
AEHAQEIAERLEKAGIKGILNFAPVKIKVSVPVENIDITASLRVLTFEIV
RRN

3D structure

PDB

7wb3 Structural Basis of Redox-Sensing Transcriptional Repressor Rex with Cofactor NAD + and Operator DNA.

Chain

Resolution

2.401 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	S32 S33 R48 K49 E56 G58 R60 G61 V62 G63 Y64	S28 S29 R44 K45 E52 G54 R56 G57 V58 G59 Y60
BS02	dna	A	P6 K7 P8 R12 K43 Q46 R60	P2 K3 P4 R8 K39 Q42 R56
BS03	NAD	A	G91 N92 I93 D115 S116 K120 V134 A152 V153 P154 A177 P178 I192	G87 N88 I89 D111 S112 K116 V130 A148 V149 P150 A173 P174 I188
BS04	NAD	A	A96 Y100	A92 Y96

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0051775	response to redox state

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7wb3, PDBe:7wb3, PDBj:7wb3
PDBsum	7wb3
PubMed	35163512
UniProt	Q9WY16\|REX1_THEMA Redox-sensing transcriptional repressor Rex 1 (Gene Name=rex1)

[Back to BioLiP]