Structure of PDB 7w2a Chain A

Receptor sequence

>7w2aA (length=354) Species: 32009 (Burkholderia gladioli pv. gladioli)

LVPNDTRYSEQWGYASGVGGANLPKAWDITTGSDKVVVAVVDTGYRPHAD
LAANILPGYDFISDPDSANDGNGRDNNAADPGDWVTQQEVDDPNGPFYRC
QLDQFGNTFASNSSWHGTHVAGTIGAVSNNGTGVAGISWKGKILPVRVLG
KCGGTLSDIADGMRWAAGLSVPGAPANPNPASVLNFSLGGGGSCSRTYQN
AINAVVAKGATVVVAAGNEASPVSSSQPANCQNVIAVAATDINGRRASFT
NTGSLVKIAAPGVNILSTLNSGTKSPAADSYASYNGTSMATPHVAGTVAL
MLAANGSLTPSQILQKLQASARPFPSGSGCSTSTCGAGLLDAGAAVNAAR
QHHH

3D structure

• PDB: 7w2a Crystal structure of a Burkholderia peptidase and modification of the substrate-binding site for enhanced hydrolytic activity toward gluten-derived pro-immunogenic peptides.
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D118 D163 H229 V240 N243 T245 V247 S401	D5 D50 H116 V127 N130 T132 V134 S288
BS02	CA	A	D183 N185 G186 D188	D70 N72 G73 D75
BS03	CA	A	D173 D183 D188 N190	D60 D70 D75 N77

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Feb 19 04:57:48 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7w2a', asym_id = 'A', title = 'Crystal structure of a Burkholderia peptidase an... toward gluten-derived pro-immunogenic peptides. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7w2a', asym_id='A', title='Crystal structure of a Burkholderia peptidase an... toward gluten-derived pro-immunogenic peptides. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004252,0006508,0008236', uniprot = '', pdbid = '7w2a', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004252,0006508,0008236', uniprot='', pdbid='7w2a', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>