Structure of PDB 7w20 Chain A

Receptor sequence

>7w20A (length=433) Species: 9823 (Sus scrofa)

APKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDW
ILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTC
KDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIRE
AYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRL
KPPFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKL
FNISGHVNHPCTVEEEMSVPLKELIEKHAGGVIGGWDNLLAVIPGGSSTP
LIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYK
HESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIEGHTIC
ALGDGAAWPVQGLIRHFRPELEERMQQFALQHQ

3D structure

• PDB: 7w20 The coupling mechanism of mammalian mitochondrial complex I.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	I205 P223 C379 C382 C385 T423 C425 L427	I180 P198 C354 C357 C360 T398 C400 L402
BS02	FMN	A	G87 G89 K98 N116 D118 E119 Y204 G207 E208 A243 N244	G62 G64 K73 N91 D93 E94 Y179 G182 E183 A218 N219
BS03	NAI	A	G89 A91 F93 K98 F101 E121 Y204 E209 F229 T351	G64 A66 F68 K73 F76 E96 Y179 E184 F204 T326

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0042775 mitochondrial ATP synthesis coupled electron transport
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005829 cytosol
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7w20, PDBe:7w20, PDBj:7w20
• PDBsum: 7w20
• PubMed: 35145322
• UniProt: A0A4X1SZP7