Structure of PDB 7w1p Chain A

Receptor sequence

>7w1pA (length=431) Species: 9823 (Sus scrofa)

KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWIL
GEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKD
REIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAY
EAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKP
PFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFN
ISGHVNHPCTVEEEMSVPLKELIEKHAGGVIGGWDNLLAVIPGGSSTPLI
PKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHE
SCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIEGHTICAL
GDGAAWPVQGLIRHFRPELEERMQQFALQHQ

3D structure

• PDB: 7w1p The coupling mechanism of mammalian mitochondrial complex I.
• Chain: A
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	I205 P223 C379 G380 Q381 C382 C385 T423 C425 L427	I178 P196 C352 G353 Q354 C355 C358 T396 C398 L400
BS02	FMN	A	G87 R88 G89 N116 D118 E119 G207 E208 A243 N244 L427	G60 R61 G62 N89 D91 E92 G180 E181 A216 N217 L400
BS03	NAI	A	G89 G90 A91 F93 E121 Y204 E209 F229 T351	G62 G63 A64 F66 E94 Y177 E182 F202 T324

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0042775 mitochondrial ATP synthesis coupled electron transport
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005829 cytosol
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7w1p, PDBe:7w1p, PDBj:7w1p
• PDBsum: 7w1p
• PubMed: 35145322
• UniProt: A0A4X1SZP7