Structure of PDB 7w1m Chain A

Receptor sequence
>7w1mA (length=399) Species: 9606 (Homo sapiens) [Search protein sequence]
GFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGE
KTSNLRVKTLRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIVGG
SSEYKINNKVVQLHEYSEELEKLGILIKARNFLVFQGAVESIAMKNPKER
TALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQ
AMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFES
VATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMD
NLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKE
QSTCNFQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPD
3D structure
PDB7w1m Cryo-EM structure of human cohesin-CTCF complex
ChainA
Resolution6.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K59 T60 L61 K58 T59 L60
BS02 ADP A K13 G35 G37 K38 S39 R57 G67 P69 K12 G34 G36 K37 S38 R56 G66 P68
BS03 ADP A K1120 R1123 S1129 K294 R297 S303
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0036033 mediator complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0006281 DNA repair
GO:0007062 sister chromatid cohesion
GO:0007064 mitotic sister chromatid cohesion
GO:0009314 response to radiation
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0034089 establishment of meiotic sister chromatid cohesion
GO:0035019 somatic stem cell population maintenance
GO:0051276 chromosome organization
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0072423 response to DNA damage checkpoint signaling
GO:0090307 mitotic spindle assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0008278 cohesin complex
GO:0016363 nuclear matrix
GO:0030892 mitotic cohesin complex
GO:0030893 meiotic cohesin complex
GO:0097431 mitotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w1m, PDBe:7w1m, PDBj:7w1m
PDBsum7w1m
PubMed37536339
UniProtQ14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A (Gene Name=SMC1A)

[Back to BioLiP]