Structure of PDB 7vw1 Chain A |
>7vw1A (length=85) Species: 562 (Escherichia coli) [Search protein sequence] |
SSASSQEYMAGMKNMHEKMMAAVNESNPDKAFAKGMIAHHEGAIAMAETE LKYGKDPEMRKLAQDIIKAQKGEIEQMNKWLDSHK |
|
PDB | 7vw1 Structural basis of copper binding by a dimeric periplasmic protein forming a six-helical bundle. |
Chain | A |
Resolution | 2.494 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H70 H71 |
H39 H40 |
|
|
|
|