Structure of PDB 7vrq Chain A |
>7vrqA (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSHMQDPEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDII KHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYEYNPPDHDVVAMAR KLQDVFEFRYAKMP |
|
PDB | 7vrq Structural and biochemical insights into purine-based drug molecules in hBRD2 delineate a unique binding mode opening new vistas in the design of inhibitors of the BET family. |
Chain | A |
Resolution | 1.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
37T |
A |
P371 V376 N429 |
P31 V36 N89 |
|
|
|