Structure of PDB 7vro Chain A |
>7vroA (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] |
RVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDM GTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIF LQKVASMPQ |
|
PDB | 7vro Structural and biochemical insights into purine-based drug molecules in hBRD2 delineate a unique binding mode opening new vistas in the design of inhibitors of the BET family. |
Chain | A |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
37T |
A |
P98 L108 N156 I162 |
P25 L35 N83 I89 |
|
|
|