Structure of PDB 7vr7 Chain A

Receptor sequence

>7vr7A (length=402) Species: 9606 (Homo sapiens) [Search protein sequence]

NLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLI
LPLIISSLITGLSGLDGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNP
SSLDAFLDLIRNLFPENLVQACFQQIQTVTKIKKGLEFKDGMNVLGLIGF
FIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICG
KIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFF
AGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINM
DGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLV
TMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSK
SE

3D structure

PDB

7vr7 Structural insights into inhibitory mechanism of human excitatory amino acid transporter EAAT2.

Chain

Resolution

3.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GJ0	A	S364 M398 T401 Y404 G446 L447 M450 I464 L467 V468 D471 D475 R478 T479 N482	S266 M300 T303 Y306 G348 L349 M352 I366 L369 V370 D373 D377 R380 T381 N384
BS02	9Z9	A	S100 L101 L108 V437 G438 S441 I442	S57 L58 L65 V339 G340 S343 I344
BS03	CLR	A	L45 W286	L2 W188
BS04	CLR	A	I325 F348 W355 M477 S480	I227 F250 W257 M379 S382

Gene Ontology

	Molecular Function
GO:0005313	L-glutamate transmembrane transporter activity
GO:0005314	high-affinity L-glutamate transmembrane transporter activity
GO:0005515	protein binding
GO:0008509	monoatomic anion transmembrane transporter activity
GO:0015175	neutral L-amino acid transmembrane transporter activity
GO:0015179	L-amino acid transmembrane transporter activity
GO:0015293	symporter activity
GO:0015501	glutamate:sodium symporter activity
GO:0033229	cysteine transmembrane transporter activity
GO:0046872	metal ion binding

	Biological Process
GO:0006750	glutathione biosynthetic process
GO:0006811	monoatomic ion transport
GO:0006836	neurotransmitter transport
GO:0006865	amino acid transport
GO:0007268	chemical synaptic transmission
GO:0007399	nervous system development
GO:0007632	visual behavior
GO:0009410	response to xenobiotic stimulus
GO:0009416	response to light stimulus
GO:0009611	response to wounding
GO:0015804	neutral amino acid transport
GO:0015813	L-glutamate transmembrane transport
GO:0021537	telencephalon development
GO:0030534	adult behavior
GO:0035264	multicellular organism growth
GO:0043200	response to amino acid
GO:0046326	positive regulation of D-glucose import
GO:0070207	protein homotrimerization
GO:0070633	transepithelial transport
GO:0070778	L-aspartate transmembrane transport
GO:0070779	D-aspartate import across plasma membrane
GO:0071314	cellular response to cocaine
GO:0098656	monoatomic anion transmembrane transport
GO:0098712	L-glutamate import across plasma membrane
GO:0098810	neurotransmitter reuptake
GO:0140009	L-aspartate import across plasma membrane
GO:0150104	transport across blood-brain barrier
GO:1903712	cysteine transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0009986	cell surface
GO:0016020	membrane
GO:0030424	axon
GO:0030673	axolemma
GO:0031982	vesicle
GO:0042734	presynaptic membrane
GO:0044297	cell body
GO:0044306	neuron projection terminus
GO:0045121	membrane raft
GO:0045202	synapse
GO:0097449	astrocyte projection
GO:0098796	membrane protein complex
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7vr7, PDBe:7vr7, PDBj:7vr7
PDBsum	7vr7
PubMed	35953475
UniProt	P43004\|EAA2_HUMAN Excitatory amino acid transporter 2 (Gene Name=SLC1A2)

[Back to BioLiP]