Structure of PDB 7v9b Chain A

Receptor sequence

>7v9bA (length=231) Species: 9606 (Homo sapiens) [Search protein sequence]

DDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKN
VIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDIL
DVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVA
YKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDD
AIAELDTLSEESYKDSTLIMQLLRDNLTLWT

3D structure

PDB

7v9b Structure of a 14-3-3 epsilon :FOXO3a pS253 Phosphopeptide Complex Reveals 14-3-3 Isoform-Specific Binding of Forkhead Box Class O Transcription Factor (FOXO) Phosphoproteins.

Chain

Resolution

1.85 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K50 R57 R130 Y131 G172 L175 N176 V179 E183 I220 N227 W231	K49 R56 R129 Y130 G171 L174 N175 V178 E182 I219 N226 W230

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005246	calcium channel regulator activity
GO:0005515	protein binding
GO:0015459	potassium channel regulator activity
GO:0019855	calcium channel inhibitor activity
GO:0019899	enzyme binding
GO:0019903	protein phosphatase binding
GO:0019904	protein domain specific binding
GO:0023026	MHC class II protein complex binding
GO:0031625	ubiquitin protein ligase binding
GO:0035591	signaling adaptor activity
GO:0042802	identical protein binding
GO:0042826	histone deacetylase binding
GO:0044325	transmembrane transporter binding
GO:0045296	cadherin binding
GO:0046982	protein heterodimerization activity
GO:0050815	phosphoserine residue binding
GO:0051219	phosphoprotein binding
GO:0097110	scaffold protein binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0000165	MAPK cascade
GO:0001764	neuron migration
GO:0002753	cytoplasmic pattern recognition receptor signaling pathway
GO:0003064	regulation of heart rate by hormone
GO:0006605	protein targeting
GO:0007165	signal transduction
GO:0007346	regulation of mitotic cell cycle
GO:0008104	protein localization
GO:0021762	substantia nigra development
GO:0021766	hippocampus development
GO:0021987	cerebral cortex development
GO:0034122	negative regulation of toll-like receptor signaling pathway
GO:0034504	protein localization to nucleus
GO:0034605	cellular response to heat
GO:0035332	positive regulation of hippo signaling
GO:0035556	intracellular signal transduction
GO:0046827	positive regulation of protein export from nucleus
GO:0051220	cytoplasmic sequestering of protein
GO:0051480	regulation of cytosolic calcium ion concentration
GO:0060306	regulation of membrane repolarization
GO:0070972	protein localization to endoplasmic reticulum
GO:0086013	membrane repolarization during cardiac muscle cell action potential
GO:0086091	regulation of heart rate by cardiac conduction
GO:1901016	regulation of potassium ion transmembrane transporter activity
GO:1905913	negative regulation of calcium ion export across plasma membrane

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0042470	melanosome
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7v9b, PDBe:7v9b, PDBj:7v9b
PDBsum	7v9b
PubMed	35874228
UniProt	P62258\|1433E_HUMAN 14-3-3 protein epsilon (Gene Name=YWHAE)

[Back to BioLiP]