Structure of PDB 7ui6 Chain A

Receptor sequence
>7ui6A (length=609) Species: 9606 (Homo sapiens) [Search protein sequence]
TIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADSIAEQILATLF
QTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLE
RVIVLDTDITFATDIAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNHR
PWPALGRGYNTGVILLLLDKLRKMKWEQMWRLTAERELMGMLSTSLADQD
IFNAVIKQNPFLVYQLPCFWNVQLSDHTRSEQCYRDVSDLKVIHWNSPKK
LRVKNKHVEFFRNLYLTFLEYDGNLLRRNSENLQKQLSELDEDDLCYEFR
RERFTVHRTHLYFLHYEYEPAADSTDVTLVAQLSMDRLQMLEAICKHWEG
PISLALYLSDAEAQQFLRYAQGSEVLMSRHNVGYHIVYKEGQFYPVNLLR
NVAMKHISTPYMFLSDIDFLPMYGLYEYLRKSVIQLDLANTKKAMIVPAF
ETLRYRLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTATT
PYRVEWEADFEPYVVVRRDCPEYDRRFVGFGWNKVAHIMELDVQEYEFIV
LPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKEEFQQDMSRRYGFAAL
KYLTAENNS
3D structure
PDB7ui6 CryoEM structure of LARGE1 from C1 reconstruction
ChainA
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.4.-.-
2.4.1.-
2.4.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A D242 D244 H380 D106 D108 H244
BS02 MN A H705 H708 H558 H561
Gene Ontology
Molecular Function
GO:0008194 UDP-glycosyltransferase activity
GO:0008375 acetylglucosaminyltransferase activity
GO:0015020 glucuronosyltransferase activity
GO:0016757 glycosyltransferase activity
GO:0016758 hexosyltransferase activity
GO:0030145 manganese ion binding
GO:0035252 UDP-xylosyltransferase activity
GO:0042285 xylosyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0001568 blood vessel development
GO:0001662 behavioral fear response
GO:0001764 neuron migration
GO:0006044 N-acetylglucosamine metabolic process
GO:0006486 protein glycosylation
GO:0006493 protein O-linked glycosylation
GO:0006612 protein targeting to membrane
GO:0006688 glycosphingolipid biosynthetic process
GO:0006833 water transport
GO:0006886 intracellular protein transport
GO:0006941 striated muscle contraction
GO:0007009 plasma membrane organization
GO:0007010 cytoskeleton organization
GO:0007268 chemical synaptic transmission
GO:0007274 neuromuscular synaptic transmission
GO:0007420 brain development
GO:0007507 heart development
GO:0007517 muscle organ development
GO:0007528 neuromuscular junction development
GO:0007605 sensory perception of sound
GO:0007613 memory
GO:0008104 protein localization
GO:0008340 determination of adult lifespan
GO:0009100 glycoprotein metabolic process
GO:0009101 glycoprotein biosynthetic process
GO:0009416 response to light stimulus
GO:0009612 response to mechanical stimulus
GO:0010467 gene expression
GO:0010842 retina layer formation
GO:0014902 myotube differentiation
GO:0021542 dentate gyrus development
GO:0021675 nerve development
GO:0021740 principal sensory nucleus of trigeminal nerve development
GO:0030225 macrophage differentiation
GO:0035129 post-embryonic hindlimb morphogenesis
GO:0035264 multicellular organism growth
GO:0035269 protein O-linked mannosylation
GO:0036211 protein modification process
GO:0042552 myelination
GO:0043403 skeletal muscle tissue regeneration
GO:0043687 post-translational protein modification
GO:0046716 muscle cell cellular homeostasis
GO:0048167 regulation of synaptic plasticity
GO:0048708 astrocyte differentiation
GO:0048738 cardiac muscle tissue development
GO:0048741 skeletal muscle fiber development
GO:0050808 synapse organization
GO:0050884 neuromuscular process controlling posture
GO:0050905 neuromuscular process
GO:0051124 synaptic assembly at neuromuscular junction
GO:0051674 localization of cell
GO:0055002 striated muscle cell development
GO:0055013 cardiac muscle cell development
GO:0055085 transmembrane transport
GO:0060041 retina development in camera-type eye
GO:0060173 limb development
GO:0060291 long-term synaptic potentiation
GO:0060348 bone development
GO:0060538 skeletal muscle organ development
GO:0061298 retina vasculature development in camera-type eye
GO:0061448 connective tissue development
GO:0065003 protein-containing complex assembly
GO:0071711 basement membrane organization
GO:0071805 potassium ion transmembrane transport
GO:0072657 protein localization to membrane
GO:0072659 protein localization to plasma membrane
GO:0090659 walking behavior
GO:0095500 acetylcholine receptor signaling pathway
GO:0098528 skeletal muscle fiber differentiation
GO:0150103 reactive gliosis
Cellular Component
GO:0000139 Golgi membrane
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0031594 neuromuscular junction
GO:0032991 protein-containing complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ui6, PDBe:7ui6, PDBj:7ui6
PDBsum7ui6
PubMed
UniProtO95461|LARG1_HUMAN Xylosyl- and glucuronyltransferase LARGE1 (Gene Name=LARGE1)

[Back to BioLiP]