Structure of PDB 7ubl Chain A

Receptor sequence
>7ublA (length=141) Species: 2681611 (Escherichia phage Lambda) [Search protein sequence]
SDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAYADYCRS
AATPGARCRDCHGTGRAVDIAKTKLWGRVVEKECGRCKGVGYSRMPASAA
YRAVTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNI
3D structure
PDB7ubl In transcription antitermination by Q lambda , NusA induces refolding of Q lambda to form a nozzle that extends the RNA polymerase RNA-exit channel.
ChainA
Resolution2.177 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D120 A127 V128 K142 A157 S158 R162 Q173 S177 R178 K181 D60 A67 V68 K82 A97 S98 R102 Q113 S117 R118 K121
BS02 dna A R82 R119 R146 K148 R154 T172 T175 R178 R22 R59 R86 K88 R94 T112 T115 R118
BS03 ZN A C118 C121 C144 C147 C58 C61 C84 C87
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7ubl, PDBe:7ubl, PDBj:7ubl
PDBsum7ubl
PubMed35951650
UniProtP03047|REGQ_LAMBD Antitermination protein Q (Gene Name=Q)

[Back to BioLiP]