Structure of PDB 7uaj Chain A

Receptor sequence
>7uajA (length=511) Species: 83333,333760 [Search protein sequence]
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQ
VAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRY
NGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMF
NLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLI
KNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPT
FKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVIN
AASGRQTVDEALKDAQTNSSSENQERPRKLPQLCTELQTTIHDIILECVY
CKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYSYS
LYGTTLEQQYNKPLSDLLIRCINCQKPLSPEEKQRHLDKKQRFHNIRGRW
TGRCMSCSRSS
3D structure
PDB7uaj Disorder-to-order transition of the interdomain linker of HPV E6 upon E6AP binding reshapes p53 binding pocket
ChainA
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A D15 E112 Y156 W231 D15 E112 Y156 W231
BS02 GLC A W63 D66 R67 E154 P155 Y156 W341 W63 D66 R67 E154 P155 Y156 W341
BS03 ZN A C408 C411 C441 C444 C398 C401 C431 C434
BS04 ZN A C484 C514 C517 C474 C504 C507
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:0030165 PDZ domain binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1901982 maltose binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
GO:0008643 carbohydrate transport
GO:0015768 maltose transport
GO:0019049 virus-mediated perturbation of host defense response
GO:0030162 regulation of proteolysis
GO:0034219 carbohydrate transmembrane transport
GO:0034289 detection of maltose stimulus
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648 symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653 symbiont-mediated suppression of host transcription
GO:0042956 maltodextrin transmembrane transport
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0052150 symbiont-mediated perturbation of host apoptosis
GO:0055085 transmembrane transport
GO:0060326 cell chemotaxis
GO:0090630 activation of GTPase activity
Cellular Component
GO:0016020 membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0042597 periplasmic space
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 maltose transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uaj, PDBe:7uaj, PDBj:7uaj
PDBsum7uaj
PubMed
UniProtP03126|VE6_HPV16 Protein E6 (Gene Name=E6);
P0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE)

[Back to BioLiP]