Structure of PDB 7u8g Chain A

Receptor sequence

>7u8gA (length=260) Species: 9606 (Homo sapiens) [Search protein sequence]

NEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAP
AACLNFNCMLILLPVCRNRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCV
NARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGI
TGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERI
VRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPM
FLYLCERLVR

3D structure

PDB

7u8g Structure of the core human NADPH oxidase NOX2.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	V71 L98 H101 K102 A105 W106 I189 R198 F205 H209 F212 F216 Y280 R287	V65 L71 H74 K75 A78 W79 I162 R171 F178 H182 F185 F189 Y253 R260
BS02	HEM	A	L60 S112 H115 T116 H119 I182 T183 F215 L219 H222 G223 R226 V228 P267	L54 S85 H88 T89 H92 I155 T156 F188 L192 H195 G196 R199 V201 P240

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0009055	electron transfer activity
GO:0016175	superoxide-generating NAD(P)H oxidase activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity
GO:0050660	flavin adenine dinucleotide binding
GO:0050664	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor

	Biological Process
GO:0006091	generation of precursor metabolites and energy
GO:0006801	superoxide metabolic process
GO:0006952	defense response
GO:0006954	inflammatory response
GO:0007584	response to nutrient
GO:0008218	bioluminescence
GO:0009410	response to xenobiotic stimulus
GO:0032760	positive regulation of tumor necrosis factor production
GO:0034220	monoatomic ion transmembrane transport
GO:0042554	superoxide anion generation
GO:0045087	innate immune response
GO:0045730	respiratory burst
GO:0045766	positive regulation of angiogenesis
GO:0050665	hydrogen peroxide biosynthetic process
GO:0071276	cellular response to cadmium ion
GO:0071361	cellular response to ethanol
GO:0071456	cellular response to hypoxia
GO:0097411	hypoxia-inducible factor-1alpha signaling pathway
GO:1904044	response to aldosterone
GO:1904845	cellular response to L-glutamine
GO:1990776	response to angiotensin

	Cellular Component
GO:0005635	nuclear envelope
GO:0005737	cytoplasm
GO:0005789	endoplasmic reticulum membrane
GO:0005886	plasma membrane
GO:0030425	dendrite
GO:0030670	phagocytic vesicle membrane
GO:0034702	monoatomic ion channel complex
GO:0035579	specific granule membrane
GO:0043020	NADPH oxidase complex
GO:0043025	neuronal cell body
GO:0045335	phagocytic vesicle
GO:0070821	tertiary granule membrane
GO:0097038	perinuclear endoplasmic reticulum

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7u8g, PDBe:7u8g, PDBj:7u8g
PDBsum	7u8g
PubMed	36241643
UniProt	P04839\|CY24B_HUMAN Cytochrome b-245 heavy chain (Gene Name=CYBB)

[Back to BioLiP]