Structure of PDB 7u50 Chain A

Receptor sequence
>7u50A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7u50 Structural basis for APE1 processing DNA damage in the nucleosome.
ChainA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A R42 R72 R83 F84 R116 T118 M120 R4 R34 R45 F46 R78 T80 M82
BS02 dna A R40 Y41 P43 V46 R49 R63 K64 L65 P66 R69 R2 Y3 P5 V8 R11 R25 K26 L27 P28 R31
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7u50, PDBe:7u50, PDBj:7u50
PDBsum7u50
PubMed36104361
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]