Structure of PDB 7ttj Chain A

Receptor sequence
>7ttjA (length=643) Species: 9606 (Homo sapiens) [Search protein sequence]
SYTVTVATGSQEHAGTDDYIYLSLVGSAGCSEKHLLDSFERGAVDSYDVT
VDEELGEIQLVRIEKRKYGSNDDWYLKYITLKTPHGDYIEFPCYRWITGD
VEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSID
AKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFAD
FEKIFVKISNTISERVMNHWQEDLMFGYQFLNGANPVLIRRCTELPEKLP
VTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDLQFLAAPICLLYK
NLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQT
ITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQG
GHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEA
IRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVK
SREQLSEYLTVVIFTASAQHAAVNFGQYDWASWIPNAPPTMRAPPPTAKG
VVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPV
KEAMARFRKNLEAIVSVIAERNENLQLPYYYLSPDRIPNSVAI
3D structure
PDB7ttj Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.13.11.-
1.13.11.34: arachidonate 5-lipoxygenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE2 A H367 H372 H550 N554 I673 H353 H358 H520 N524 I643
Gene Ontology
Molecular Function
GO:0004051 arachidonate 5-lipoxygenase activity
GO:0004052 arachidonate 12(S)-lipoxygenase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0016787 hydrolase activity
GO:0036403 arachidonate 8(S)-lipoxygenase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0001676 long-chain fatty acid metabolic process
GO:0001937 negative regulation of endothelial cell proliferation
GO:0002232 leukocyte chemotaxis involved in inflammatory response
GO:0002523 leukocyte migration involved in inflammatory response
GO:0002540 leukotriene production involved in inflammatory response
GO:0006629 lipid metabolic process
GO:0006690 icosanoid metabolic process
GO:0006691 leukotriene metabolic process
GO:0006954 inflammatory response
GO:0006959 humoral immune response
GO:0016525 negative regulation of angiogenesis
GO:0019369 arachidonate metabolic process
GO:0019370 leukotriene biosynthetic process
GO:0019372 lipoxygenase pathway
GO:0030501 positive regulation of bone mineralization
GO:0034440 lipid oxidation
GO:0036336 dendritic cell migration
GO:0042593 glucose homeostasis
GO:0042759 long-chain fatty acid biosynthetic process
GO:0045598 regulation of fat cell differentiation
GO:0050727 regulation of inflammatory response
GO:0050728 negative regulation of inflammatory response
GO:0050796 regulation of insulin secretion
GO:0061044 negative regulation of vascular wound healing
GO:0061045 negative regulation of wound healing
GO:0106014 regulation of inflammatory response to wounding
GO:1900015 regulation of cytokine production involved in inflammatory response
GO:1900407 regulation of cellular response to oxidative stress
GO:1901753 leukotriene A4 biosynthetic process
GO:1903426 regulation of reactive oxygen species biosynthetic process
GO:1903573 negative regulation of response to endoplasmic reticulum stress
GO:1903671 negative regulation of sprouting angiogenesis
GO:1904999 positive regulation of leukocyte adhesion to arterial endothelial cell
GO:2001301 lipoxin biosynthetic process
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005641 nuclear envelope lumen
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016363 nuclear matrix
GO:0031965 nuclear membrane
GO:0034774 secretory granule lumen
GO:0048471 perinuclear region of cytoplasm
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttj, PDBe:7ttj, PDBj:7ttj
PDBsum7ttj
PubMed35863431
UniProtP09917|LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase (Gene Name=ALOX5)

[Back to BioLiP]