Structure of PDB 7th4 Chain A

Receptor sequence

>7th4A (length=291) Species: 300852 (Thermus thermophilus HB8)

MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITY
GAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGV
ENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYP
EGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGI
GIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIG
VEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP

3D structure

• PDB: 7th4 5-Formyltetrahydrofolate promotes conformational remodeling in a methylenetetrahydrofolate reductase active site and inhibits its activity.
• Chain: A
• Resolution: 1.45 Å

Enzymatic activity

• Enzyme Commision number: 1.5.1.54: methylenetetrahydrofolate reductase (NADH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	T49 Y50 A52 H77 T79 L106 R107 G108 D109 Y126 A127 A147 Y149 H153 E155 S156 H165 K169 I178 Q180 Y272	T49 Y50 A52 H77 T79 L106 R107 G108 D109 Y126 A127 A147 Y149 H153 E155 S156 H165 K169 I178 Q180 Y272
BS02	FFO	A	F20 K23 T49 D109 Q180 M209 Q216 R219 V223 Y272	F20 K23 T49 D109 Q180 M209 Q216 R219 V223 Y272

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004489 methylenetetrahydrofolate reductase (NAD(P)H) activity
• GO:0016491 oxidoreductase activity
• GO:0071949 FAD binding
• GO:0106312 methylenetetrahydrofolate reductase (NADH) activity

Biological Process

• GO:0006555 methionine metabolic process
• GO:0009086 methionine biosynthetic process
• GO:0035999 tetrahydrofolate interconversion

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:7th4, PDBe:7th4, PDBj:7th4
• PDBsum: 7th4
• PubMed: 36592927
• UniProt: Q5SLG6