Structure of PDB 7tep Chain A

Receptor sequence

>7tepA (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKCTCNA
CHQKYR

3D structure

• PDB: 7tep Redox- and metal-directed structural diversification in designed metalloprotein assemblies.
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	M7 L10 L14 P46 F61 F65 L68 C98 C101 H102 Y105 R106	M7 L10 L14 P46 F61 F65 L68 C98 C101 H102 Y105 R106
BS02	CU	A	H77 E81	H77 E81

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:7tep, PDBe:7tep, PDBj:7tep
• PDBsum: 7tep
• PubMed: 35642584
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)