Structure of PDB 7tdx Chain A

Receptor sequence
>7tdxA (length=90) Species: 10090 (Mus musculus) [Search protein sequence]
PEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMF
AYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEF
3D structure
PDB7tdx The transcription factor FoxP3 can fold into two dimerization states with divergent implications for regulatory T cell function and immune homeostasis.
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A L360 R386 H387 S390 R397 W406 L39 R65 H66 S69 R76 W85
BS02 dna A R337 T341 Y342 N383 H387 R16 T20 Y21 N62 H66
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7tdx, PDBe:7tdx, PDBj:7tdx
PDBsum7tdx
PubMed35926508
UniProtQ99JB6|FOXP3_MOUSE Forkhead box protein P3 (Gene Name=Foxp3)

[Back to BioLiP]