Structure of PDB 7syx Chain A

Receptor sequence
>7syxA (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
RELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINT
SDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG
3D structure
PDB7syx Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
ChainA
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A M41 L42 N44 G45 R62 G63 K64 R66 K67 W70 I71 M18 L19 N21 G22 R39 G40 K41 R43 K44 W47 I48
BS02 rna A K68 W70 K45 W47
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008135 translation factor activity, RNA binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0042255 ribosome assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016282 eukaryotic 43S preinitiation complex
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7syx, PDBe:7syx, PDBj:7syx
PDBsum7syx
PubMed35822879
UniProtP47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal (Gene Name=EIF1AX)

[Back to BioLiP]