Structure of PDB 7sv0 Chain A

Receptor sequence

>7sv0A (length=389) Species: 4558 (Sorghum bicolor)

HDAQHPCQANVAVRRELHTPASDRSCTHLEFDIAGTGLTYETGDHVGVYT
ENCPEVVEEAERLLGYSPDTFFTIHPSPITVRNALARYADLLNSPKKTSL
VALATYASDPAEADRLRFLASAAGKDEYAQWVVASQRSLLEVMAEFPSAK
PPLGVFFAAVAPRLQPRYYSISSSPSMAATRIHVTCALVHETTPAGRVHK
GVCSTWIKNAVPSEESKDCSWAPIFVRQSNFKLPADPSVPIIMIGPGTGL
APFRGFLQERLAQKESGAELGPSVFFFGCRNSKMDFIYEDELNNFLEQGA
LSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMAR
DVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW

3D structure

• PDB: 7sv0 Functional and structural insight into the flexibility of cytochrome P450 reductases from Sorghum bicolor and its implications for lignin composition.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 1.6.2.4: NADPH--hemoprotein reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	R323 E508 T565 R597 S626 R627 Y634 Q636 G664 M665	R24 E191 T248 R280 S309 R310 Y317 Q319 G347 M348
BS02	FAD	A	H344 Q453 R484 Y485 Y486 S487 T502 C503 R514 H516 G518 V519 C520 S521 T565 W706	H45 Q136 R167 Y168 Y169 S170 T185 C186 R197 H199 G201 V202 C203 S204 T248 W389

Gene Ontology

Molecular Function

• GO:0003958 NADPH-hemoprotein reductase activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050661 NADP binding

Cellular Component

• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:7sv0, PDBe:7sv0, PDBj:7sv0
• PDBsum: 7sv0
• PubMed: 35202651
• UniProt: C5YJG8|NCPR_SORBI NADPH--cytochrome P450 reductase (Gene Name=CPR)