Structure of PDB 7st4 Chain A

Receptor sequence

>7st4A (length=385) Species: 32630 (synthetic construct)

KTFKEVANAVKISASLMGLKINVYIKADKQKNGIKANFHIRHNIEDGGVQ
LAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAA
GITLKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC
TTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFK
DDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLLTEEQI
AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
DGTIDFPEFLTMMARKMKYRDTEEEIREAFGVFDKDGNGYISAAELRHVM
TNLGETDEEVDEMIREADIDGDGQVNYEEFVQMMT

3D structure

• PDB: 7st4 Fast and sensitive GCaMP calcium indicators for imaging neural populations
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D294 D296 D298 T300 E305	D261 D263 D265 T267 E272
BS02	CA	A	D330 D332 D334 T336 E341	D297 D299 D301 T303 E308
BS03	CA	A	D367 D369 N371 Y373 E378	D334 D336 N338 Y340 E345
BS04	CA	A	D403 D405 D407 Q409 E414	D368 D370 D372 Q374 E379

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 15:29:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7st4', asym_id = 'A', title = 'Fast and sensitive GCaMP calcium indicators for imaging neural populations'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7st4', asym_id='A', title='Fast and sensitive GCaMP calcium indicators for imaging neural populations')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005509,0006091,0008218', uniprot = '', pdbid = '7st4', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005509,0006091,0008218', uniprot='', pdbid='7st4', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>