Structure of PDB 7sp3 Chain A

Receptor sequence
>7sp3A (length=153) Species: 562 (Escherichia coli) [Search protein sequence]
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAM
YRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVCIGQKQKWFLLQLVSG
DAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMS
LAA
3D structure
PDB7sp3 A distinct RNA recognition mechanism governs Np 4 decapping by RppH.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 B4P A R8 R27 S32 Q37 G38 E53 Y77 L79 Q95 E120 V137 K140 R8 R27 S32 Q37 G38 E53 Y77 L79 Q88 E113 V130 K133
BS02 MG A Q37 E57 E120 Q37 E57 E113
BS03 MG A E53 E57 E120 E53 E57 E113
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005515 protein binding
GO:0016462 pyrophosphatase activity
GO:0016787 hydrolase activity
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0034353 mRNA 5'-diphosphatase activity
GO:0110153 RNA NAD-cap (NMN-forming) hydrolase activity
Biological Process
GO:0006402 mRNA catabolic process
GO:0008033 tRNA processing
GO:0050779 RNA destabilization
GO:0110154 RNA decapping
GO:0110155 NAD-cap decapping
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sp3, PDBe:7sp3, PDBj:7sp3
PDBsum7sp3
PubMed35131855
UniProtP0A776|RPPH_ECOLI RNA pyrophosphohydrolase (Gene Name=rppH)

[Back to BioLiP]