Structure of PDB 7sk5 Chain A

Receptor sequence
>7sk5A (length=300) Species: 9606 (Homo sapiens) [Search protein sequence]
VVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGY
DTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSIN
LFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSL
PDTYYLKTVTSNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIA
VFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSI
LHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKA
3D structure
PDB7sk5 Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
ChainA
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR A W208 M212 W179 M183
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005044 scavenger receptor activity
GO:0005515 protein binding
GO:0015026 coreceptor activity
GO:0016493 C-C chemokine receptor activity
GO:0016494 C-X-C chemokine receptor activity
GO:0019956 chemokine binding
GO:0019957 C-C chemokine binding
GO:0019958 C-X-C chemokine binding
Biological Process
GO:0001525 angiogenesis
GO:0001570 vasculogenesis
GO:0006935 chemotaxis
GO:0006955 immune response
GO:0007155 cell adhesion
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008285 negative regulation of cell population proliferation
GO:0019722 calcium-mediated signaling
GO:0021557 oculomotor nerve development
GO:0031623 receptor internalization
GO:0060326 cell chemotaxis
GO:0070098 chemokine-mediated signaling pathway
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:1902230 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1905322 positive regulation of mesenchymal stem cell migration
Cellular Component
GO:0005768 endosome
GO:0005769 early endosome
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0055037 recycling endosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sk5, PDBe:7sk5, PDBj:7sk5
PDBsum7sk5
PubMed35857509
UniProtP25106|ACKR3_HUMAN Atypical chemokine receptor 3 (Gene Name=ACKR3)

[Back to BioLiP]