Structure of PDB 7sjg Chain A

Receptor sequence
>7sjgA (length=137) Species: 129555 (Amphitrite ornata) [Search protein sequence]
GFKQDIATLRGDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKSDQELKSMA
KFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNFEKL
FVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK
3D structure
PDB7sjg The Multifunctional Globin Dehaloperoxidase as a Biocatalyst in the Oxidation of Monoterpenes
ChainA
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A N34 F35 H55 V59 L62 M63 L83 M86 H89 L92 N96 F97 N34 F35 H55 V59 L62 M63 L83 M86 H89 L92 N96 F97
BS02 9J9 A F21 F35 Y38 H55 T56 V59 F21 F35 Y38 H55 T56 V59
BS03 9IX A D72 C73 S119 R122 D72 C73 S119 R122
BS04 9J9 A D116 S119 D116 S119
BS05 9J9 A P29 D30 K32 P29 D30 K32
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0098869 cellular oxidant detoxification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7sjg, PDBe:7sjg, PDBj:7sjg
PDBsum7sjg
PubMed
UniProtQ9NAV7

[Back to BioLiP]