Structure of PDB 7sj3 Chain A

Receptor sequence
>7sj3A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence]
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRGGGLPISTVREVA
LLRRLEAFEHPNVVRLMDVCATSDREIKVTLVFEHVDQDLRTYLDKAPAE
TIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIY
SYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFC
GNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPEMEESGAQL
LLEMLTFNPHKRISAFRALQHSYL
3D structure
PDB7sj3 Structure of CDK4-Cyclin D3 bound to abemaciclib
ChainA
Resolution2.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.11.22: cyclin-dependent kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 6ZV A I12 Y17 A33 K35 F93 V96 D99 L147 D158 I11 Y16 A32 K34 F83 V86 D89 L132 D143
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004693 cyclin-dependent protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
GO:0030332 cyclin binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0008284 positive regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0010389 regulation of G2/M transition of mitotic cell cycle
GO:0010468 regulation of gene expression
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
GO:0016310 phosphorylation
GO:0048146 positive regulation of fibroblast proliferation
GO:0051301 cell division
GO:0051726 regulation of cell cycle
GO:0060260 regulation of transcription initiation by RNA polymerase II
GO:0061469 regulation of type B pancreatic cell proliferation
GO:0071222 cellular response to lipopolysaccharide
GO:0071353 cellular response to interleukin-4
GO:1904628 cellular response to phorbol 13-acetate 12-myristate
GO:1904637 cellular response to ionomycin
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005923 bicellular tight junction
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0097128 cyclin D1-CDK4 complex
GO:0097129 cyclin D2-CDK4 complex
GO:0097130 cyclin D3-CDK4 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sj3, PDBe:7sj3, PDBj:7sj3
PDBsum7sj3
PubMed
UniProtP11802|CDK4_HUMAN Cyclin-dependent kinase 4 (Gene Name=CDK4)

[Back to BioLiP]