Structure of PDB 7rt1 Chain A

Receptor sequence

>7rt1A (length=169) Species: 9606 (Homo sapiens)

MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
SLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQI
KRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ
GVDDAFYTLVREIRKHKEK

3D structure

• PDB: 7rt1 Identification of MRTX1133, a Noncovalent, Potent, and Selective KRAS G12D Inhibitor.
• Chain: A
• Resolution: 1.27 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	G13 G15 K16 S17 A18 D30 N116 K117 D119 L120 S145 A146 K147	G13 G15 K16 S17 A18 D30 N116 K117 D119 L120 S145 A146 K147
BS02	7L8	A	D12 G60 E62 Y64 R68 D69 M72 H95 Y96 Q99 I100	D12 G60 E62 Y64 R68 D69 M72 H95 Y96 Q99 I100
BS03	7L8	A	V7 S39 D54 L56 M67 Y71 T74	V7 S39 D54 L56 M67 Y71 T74

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:7rt1, PDBe:7rt1, PDBj:7rt1
• PDBsum: 7rt1
• PubMed: 34889605
• UniProt: P01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)