Structure of PDB 7ror Chain A

Receptor sequence

>7rorA (length=356) Species: 36329 (Plasmodium falciparum 3D7)

AQEESKIEDVDKILNDILSISSECIQPDELRVKLLLKRKLICYDGFEPSG
RMHIAQGLLKSIIVNKLTSNGCTFIFWIADWFAHLNNKMSGDLKKIKKVG
SYFIEVWKSCGMNMENVQFLWASEEINKKPNEYWSLVLDISRSFNINRMK
RCLKIMGRSEGEENYCSQILYPCMQCADIFFLNVDICQLGIDQRKVNMLA
REYCDIKKIKKKPVILSHGMLPGLLEGQEKMSKSDENSAIFMDDSESDVN
RKIKKAYCPPNVIENNPIYAYAKSIIFPSYNEFNLVRKEKNGGDKTYYTL
QELEHDYVNGFIHPLDLKDNVAMYINKLLQPVRDHFQNNIEAKNLLNEIK
KYKVTK

3D structure

• PDB: 7ror Reaction hijacking of tyrosine tRNA synthetase as a new whole-of-life-cycle antimalarial strategy.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 6.1.1.1: tyrosine--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	69X	A	Y60 D61 G62 F63 E64 H70 A72 Q73 W94 F99 I172 Y188 Q192 D195 L206 G207 D209 Q210 H235 M237 L238 K247 M248	Y43 D44 G45 F46 E47 H53 A55 Q56 W77 F82 I155 Y171 Q175 D178 L189 G190 D192 Q193 H218 M220 L221 K230 M231
BS02	MG	A	R304 D311	R287 D294
BS03	MG	A	M131 V134	M114 V117

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0004831 tyrosine-tRNA ligase activity
• GO:0005524 ATP binding
• GO:0046789 host cell surface receptor binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0006418 tRNA aminoacylation for protein translation
• GO:0006437 tyrosyl-tRNA aminoacylation
• GO:0044650 adhesion of symbiont to host cell

Cellular Component

• GO:0005737 cytoplasm
• GO:0044164 host cell cytosol

External links

• PDB: RCSB:7ror, PDBe:7ror, PDBj:7ror
• PDBsum: 7ror
• PubMed: 35653481
• UniProt: Q8IAR7