Structure of PDB 7rnb Chain A |
>7rnbA (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] |
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET |
|
PDB | 7rnb Structure-Based Design and Biological Evaluation of Novel Caspase-2 Inhibitors Based on the Peptide AcVDVAD-CHO and the Caspase-2-Mediated Tau Cleavage Sequence YKPVD314. |
Chain | A |
Resolution | 1.75 Å |
3D structure |
|
|
Enzyme Commision number |
3.4.22.56: caspase-3. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R64 H121 C163 |
R31 H88 C130 |
|
|
|
|