Structure of PDB 7rk3 Chain A

Receptor sequence

>7rk3A (length=352) Species: 9606 (Homo sapiens)

IRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSP
EFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVE
INFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTC
RYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETK
DIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEV
TDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKM
KGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLV
LQ

3D structure

• PDB: 7rk3 Crystal structure of human N-myristoyltransferase 1 fragment (residues 109-496) bound to diacylated human Arf6 octapeptide and Coenzyme A
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y180 V181 D183 D185 F188 R189 F190 Y192 T282 G284 Y296 H298 F311 S312 I469 G470 D471 G472 L474	Y36 V37 D39 D41 F44 R45 F46 Y48 T138 G140 Y152 H154 F167 S168 I325 G326 D327 G328 L330
BS02	4PS	A	Y180 V181 L248 C249 V250 R255 S256 R258 A260 P261	Y36 V37 L104 C105 V106 R111 S112 R114 A116 P117
BS03	6NA	A	Y296 Y401 Y420 S421 L453 V494	Y152 Y257 Y276 S277 L309 V350

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:7rk3, PDBe:7rk3, PDBj:7rk3
• PDBsum: 7rk3
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)