Structure of PDB 7ra0 Chain A

Receptor sequence
>7ra0A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence]
DRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFL
VPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEK
DEDGFLYMVYASQET
3D structure
PDB7ra0 A Multifaceted Hit-Finding Approach Reveals Novel LC3 Family Ligands.
ChainA
Resolution1.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 2JI A K30 P55 I66 K27 P52 I63
BS02 2JI A H86 S87 V91 I98 E102 H83 S84 V88 I95 E99
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0007254 JNK cascade
GO:0009267 cellular response to starvation
GO:0010040 response to iron(II) ion
GO:0010288 response to lead ion
GO:0016236 macroautophagy
GO:0031667 response to nutrient levels
GO:0034198 cellular response to amino acid starvation
GO:0038066 p38MAPK cascade
GO:0060395 SMAD protein signal transduction
GO:0070301 cellular response to hydrogen peroxide
GO:0071280 cellular response to copper ion
GO:0090650 cellular response to oxygen-glucose deprivation
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005770 late endosome
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031090 organelle membrane
GO:0031410 cytoplasmic vesicle
GO:0043231 intracellular membrane-bounded organelle
GO:0044754 autolysosome
GO:0045202 synapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ra0, PDBe:7ra0, PDBj:7ra0
PDBsum7ra0
PubMed34985287
UniProtQ9H492|MLP3A_HUMAN Microtubule-associated proteins 1A/1B light chain 3A (Gene Name=MAP1LC3A)

[Back to BioLiP]