Structure of PDB 7r4n Chain A

Receptor sequence

>7r4nA (length=352) Species: 9606 (Homo sapiens)

LPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYP
RMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSL
GTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMG
YKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFSTLSFSDSGLAAYVA
KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNH
GARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALALGAKA
VFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLV
RK

3D structure

• PDB: 7r4n Structure of human hydroxyacid oxidase 1 bound with 5-bromo-N-methyl-1H-indazole-3-carboxamide
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 1.1.3.15: (S)-2-hydroxy-acid oxidase.
  1.2.3.5: glyoxylate oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	7RI	A	Y26 A81 M82 W110 Y132 R167 M183 H260 R263	Y25 A80 M81 W109 Y131 R166 M182 H250 R253
BS02	FMN	A	Y26 Y27 A79 T80 A81 S108 W110 Q130 Y132 T158 K236 H260 G261 R263 D291 G292 R295 G314 R315	Y25 Y26 A78 T79 A80 S107 W109 Q129 Y131 T157 K226 H250 G251 R253 D281 G282 R285 G304 R305

Gene Ontology

Molecular Function

• GO:0003973 (S)-2-hydroxy-acid oxidase activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0047969 glyoxylate oxidase activity

Biological Process

• GO:0001561 fatty acid alpha-oxidation
• GO:0006545 glycine biosynthetic process
• GO:0006979 response to oxidative stress
• GO:0008652 amino acid biosynthetic process
• GO:0046296 glycolate catabolic process

Cellular Component

• GO:0005777 peroxisome
• GO:0005782 peroxisomal matrix
• GO:0005829 cytosol
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:7r4n, PDBe:7r4n, PDBj:7r4n
• PDBsum: 7r4n
• UniProt: Q9UJM8|HAOX1_HUMAN 2-Hydroxyacid oxidase 1 (Gene Name=HAO1)