Structure of PDB 7r2p Chain A

Receptor sequence

>7r2pA (length=400) Species: 83333 (Escherichia coli K-12)

SIVVKNNIHWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDTV
KHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIY
CTANAIDSINGHHHHPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDS
MMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTP
FSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQE
DRITIFYDTMYNNTRMMADAIAQGIAETDPRVAVKIFNVARSDKNEILTN
VFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGG
AVDRLSTRLQDAGFEMSLSLKAKWRPDQDALKLCREHGREIARQWALAPL

3D structure

• PDB: 7r2p Crystal structure of a flavodiiron protein D52K/S262Y mutant in the oxidized state from Escherichia coli
• Chain: A
• Resolution: 2.538 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	T260 M261 Y262 N264 T265 S313 T314 N316 N317 S345 H346 G347 W348 S349 G350 W375	T259 M260 Y261 N263 T264 S312 T313 N315 N316 S344 H345 G346 W347 S348 G349 W374
BS02	FE	A	D83 H84 D166 H227	D82 H83 D165 H226
BS03	FE	A	H79 E81 H147 D166	H78 E80 H146 D165
BS04	O	A	H79 E81 D83 H84 D166	H78 E80 D82 H83 D165

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0016661 oxidoreductase activity, acting on other nitrogenous compounds as donors
• GO:0016966 nitric oxide reductase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0046210 nitric oxide catabolic process
• GO:0071731 response to nitric oxide

Cellular Component

• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:7r2p, PDBe:7r2p, PDBj:7r2p
• PDBsum: 7r2p
• UniProt: Q46877|NORV_ECOLI Anaerobic nitric oxide reductase flavorubredoxin (Gene Name=norV)