Structure of PDB 7r0w Chain A

Receptor sequence

>7r0wA (length=222) Species: 1148 (Synechocystis sp. PCC 6803)

MFSKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTC
FLIQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMM
VLMMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQV
GYWAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPW
AIAVLLLLHFLMIRKQGISGPL

3D structure

• PDB: 7r0w Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
• Chain: A
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V37 I39	V37 I39
BS02	HEM	A	Y41 G44 G45 T47 L48 M104 H107 V108 R110 V111 G116 T124 W125 G128 V129 H209 F210 I213 I218 S219	Y41 G44 G45 T47 L48 M104 H107 V108 R110 V111 G116 T124 W125 G128 V129 H209 F210 I213 I218 S219
BS03	HEM	A	Q54 G58 M61 Y65 V76 R90 H93 A97 F138 G142 L145 P146 H194 P199	Q54 G58 M61 Y65 V76 R90 H93 A97 F138 G142 L145 P146 H194 P199
BS04	ECH	A	I39 F40 L46 M103	I39 F40 L46 M103
BS05	HEM	A	V37 Y41 C42 G45 F210 R214 G217 I218	V37 Y41 C42 G45 F210 R214 G217 I218
BS06	CLA	A	I105 Y112 A132 V133	I105 Y112 A132 V133

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009512 cytochrome b6f complex
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7r0w, PDBe:7r0w, PDBj:7r0w
• PDBsum: 7r0w
• PubMed: 35726684
• UniProt: Q57038|CYB6_SYNY3 Cytochrome b6 (Gene Name=petB)