Structure of PDB 7qbu Chain A

Receptor sequence

>7qbuA (length=418) Species: 2214 (Methanosarcina acetivorans)

ENLYFQGHMEVVVDVGGNPGVDCKGFCKYCYFKKVKDIQPLGCKYCLPFK
KGCDYCTRSVKESYSGFKSLQMVLEETANKLYFTSGEVKKFTVSGGGDLS
CYPELKSLITFLSQFNTPIHLGYTSGKGFSKPDDALFYIDNGVTEVSFTV
FATDPALRAEYMKDPEPEASIQVLRDFCTHCEVYGAIVLLPGINDGEVLE
KTLCDLENMGAKGAILMRFANFQENGLILNNSPIIPGITPHTVSEFTEIV
RSSAEKHPSIRITGTPLEDPLIGSPFAIRNVPEALLKLPRVSKKATIITG
QVAASRLTEIFEALGGTVNVIPVKKDIGCLITIDDFKALDLSEVTETVFI
PGRAFVHDMEIKEALRRDGVDRIVRRGPERLSVDGEMSIGMTREEVLELE
VENFTELIGQINSLGLPL

3D structure

• PDB: 7qbu Crystallographic snapshots of a B 12 -dependent radical SAM methyltransferase.
• Chain: A
• Resolution: 2.298 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.379: [methyl coenzyme M reductase]-L-arginine C-5-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	P11 G12 C15 F18 C19 C22 Y115 S117	P19 G20 C23 F26 C27 C30 Y123 S125
BS02	FE	A	C35 C38 C45 C48	C43 C46 C53 C56
BS03	MTA	A	Y21 C22 Y23 Y115 V180 M209 F211 A212	Y29 C30 Y31 Y123 V188 M217 F219 A220
BS04	COB	A	Y23 F24 Y47 R210 A212 N217 L219 I220 L221 N223 P258 P267 F268 I289 T291 D318 I319 G320 C321 L322 F341 P343 R345 F347 G369 P370 E371 R372 L373 S374	Y31 F32 Y55 R218 A220 N225 L227 I228 L229 N231 P266 P275 F276 I297 T299 D326 I327 G328 C329 L330 F349 P351 R353 F355 G377 P378 E379 R380 L381 S382

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008168 methyltransferase activity
• GO:0035244 protein-arginine C-methyltransferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0032259 methylation
• GO:0043687 post-translational protein modification

External links

• PDB: RCSB:7qbu, PDBe:7qbu, PDBj:7qbu
• PDBsum: 7qbu
• PubMed: 35110733
• UniProt: Q8THG6|MCRAM_METAC [Methyl coenzyme M reductase]-L-arginine C-5-methyltransferase (Gene Name=MA_4551)