Structure of PDB 7q5x Chain A

Receptor sequence

>7q5xA (length=221) Species: 9606 (Homo sapiens)

PLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFT
DGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGK
LGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDA
KVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAI
TVWYFDADERARAKVKYLTGE

3D structure

• PDB: 7q5x Structural basis for binding of the renal carcinoma target hypoxia-inducible factor 2 alpha to prolyl hydroxylase domain 2.
• Chain: A
• Resolution: 1.21 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Q239 L240 V241 S242 K244 R252 W258 D277 R281 N293 G294 R295 Y310 H313 V314 D315 P317 N318 R322 W389 F391 R396 K400	Q53 L54 V55 S56 K58 R66 W72 D91 R95 N107 G108 R109 Y124 H127 V128 D129 P131 N132 R136 W203 F205 R210 K214
BS02	MN	A	H313 D315 H374	H127 D129 H188
BS03	AKG	A	Y310 H313 Y329 H374 V376 R383	Y124 H127 Y143 H188 V190 R197
BS04	MG	A	T257 W258	T71 W72

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0031418 L-ascorbic acid binding

External links

• PDB: RCSB:7q5x, PDBe:7q5x, PDBj:7q5x
• PDBsum: 7q5x
• PubMed: 37449559
• UniProt: Q9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)