Structure of PDB 7q5v Chain A

Receptor sequence

>7q5vA (length=223) Species: 9606 (Homo sapiens)

TKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGK
FTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCN
GKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDW
DAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRY
AITVWYFDADERARAKVKYLTGE

3D structure

• PDB: 7q5v Structural basis for binding of the renal carcinoma target hypoxia-inducible factor 2 alpha to prolyl hydroxylase domain 2.
• Chain: A
• Resolution: 1.17 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Q239 L240 V241 S242 I251 R252 W258 D277 R281 N293 G294 R295 Y310 H313 V314 D315 P317 N318 R322 R370 W389 F391 R396 K400 Y403	Q55 L56 V57 S58 I67 R68 W74 D93 R97 N109 G110 R111 Y126 H129 V130 D131 P133 N134 R138 R186 W205 F207 R212 K216 Y219
BS02	MN	A	H313 D315 H374	H129 D131 H190
BS03	OGA	A	Y310 H313 Y329 L343 H374 V376 R383	Y126 H129 Y145 L159 H190 V192 R199
BS04	MG	A	Q243 K244 S245 D246	Q59 K60 S61 D62
BS05	MG	A	I280 N284	I96 N100

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0031418 L-ascorbic acid binding

External links

• PDB: RCSB:7q5v, PDBe:7q5v, PDBj:7q5v
• PDBsum: 7q5v
• PubMed: 37449559
• UniProt: Q9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)