Structure of PDB 7q4p Chain A

Receptor sequence

>7q4pA (length=254) Species: 9606 (Homo sapiens) [Search protein sequence]

SAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNN
LKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKS
LSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYC
LQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYEL
DYIL

3D structure

PDB

7q4p Structural basis of branch site recognition by the human spliceosome.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	H1069 K1071 R1074 R1075 R1106 R1109 C1111 V1114 N1142 K1149 F1153 V1183 Q1186 P1224 H1225 P1257 A1258 R1259	H19 K21 R24 R25 R56 R59 C61 V64 N92 K99 F103 V133 Q136 P174 H175 P207 A208 R209

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:1990935	splicing factor binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000375	RNA splicing, via transesterification reactions
GO:0000398	mRNA splicing, via spliceosome
GO:0006338	chromatin remodeling
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0045945	positive regulation of transcription by RNA polymerase III
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005686	U2 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005730	nucleolus
GO:0016607	nuclear speck
GO:0034693	U11/U12 snRNP
GO:0071004	U2-type prespliceosome
GO:0071005	U2-type precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0110016	B-WICH complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q4p, PDBe:7q4p, PDBj:7q4p
PDBsum	7q4p
PubMed	34822310
UniProt	O75533\|SF3B1_HUMAN Splicing factor 3B subunit 1 (Gene Name=SF3B1)

[Back to BioLiP]