Structure of PDB 7ppp Chain A |
>7pppA (length=73) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] |
HCRLCHGKFSSRSLRSISDGERVFVRDFQRLLGVAVHQDPALSQFVCRNC HAQFYQCHSLLESFLQRVNVSPM |
|
PDB | 7ppp Structural insights into highly similar spatial organization of zinc-finger associated domains with a very low sequence similarity. |
Chain | A |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C4 C7 C61 C64 |
C2 C5 C47 C50 |
|
|
|
|