Structure of PDB 7poh Chain A |
>7pohA (length=88) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
PEFMDTCFFCGAVDLMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLK PGARLCPRCFQELSDYDTIMVNLMTTQKRLTTQLKLDK |
|
PDB | 7poh Structural insights into highly similar spatial organization of zinc-finger associated domains with a very low sequence similarity. |
Chain | A |
Resolution | 2.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C4 C61 C64 |
C7 C56 C59 |
|
|
|