Structure of PDB 7pii Chain A

Receptor sequence

>7piiA (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]

SRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQA
LLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGL

3D structure

PDB

7pii Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.

Chain

Resolution

2.68 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	R72 N85 W86 R118 V119 T120	R32 N45 W46 R78 V79 T80
BS02	dna	A	R42 R43 G46 R63 L65 P66 R69	R2 R3 G6 R23 L25 P26 R29
BS03	peptide	A	Q127 R130 R131 G134 L135 L139	Q87 R90 R91 G94 L95 L99

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000132	establishment of mitotic spindle orientation
GO:0000281	mitotic cytokinesis
GO:0034080	CENP-A containing chromatin assembly
GO:0051301	cell division
GO:0051382	kinetochore assembly
GO:0061644	protein localization to CENP-A containing chromatin
GO:0071459	protein localization to chromosome, centromeric region

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000779	condensed chromosome, centromeric region
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005721	pericentric heterochromatin
GO:0005829	cytosol
GO:0043505	CENP-A containing nucleosome
GO:0061638	CENP-A containing chromatin

External links

PDB	RCSB:7pii, PDBe:7pii, PDBj:7pii
PDBsum	7pii
PubMed	35420891
UniProt	P49450\|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)