Structure of PDB 7pdv Chain A |
>7pdvA (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
TIMLRGLPTTITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFY HLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCGLNNFRKR LKCFRCG |
|
PDB | 7pdv Structural basis for specific RNA recognition by the alternative splicing factor RBM5. |
Chain | A |
Resolution | 3.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C96 C99 C110 |
C89 C92 C103 |
|
|
|
|