Structure of PDB 7pcv Chain A |
>7pcvA (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
RESKTIMLRGLPTTITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAF VEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNN FRKRLKCFRCGADKFD |
|
PDB | 7pcv Structural basis for specific RNA recognition by the alternative splicing factor RBM5. |
Chain | A |
Resolution | 2.42 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C96 C99 C110 |
C93 C96 C107 |
|
|
|
|