Structure of PDB 7p52 Chain A

Receptor sequence
>7p52A (length=112) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence]
MKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGRE
YIVDLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVV
RVRTKEEGKEAL
3D structure
PDB7p52 The Oxoglutarate Binding Site and Regulatory Mechanism Are Conserved in Ammonium Transporter Inhibitors GlnKs from Methanococcales .
ChainA
Resolution1.20002 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP A I7 G35 R36 G37 V38 Q39 P86 G87 G89 K90 F92 I7 G35 R36 G37 V38 Q39 P86 G87 G89 K90 F92
BS02 AKG A R36 G37 Q39 G40 G41 I42 K58 P86 G87 R36 G37 Q39 G40 G41 I42 K58 P86 G87
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p52, PDBe:7p52, PDBj:7p52
PDBsum7p52
PubMed34445335
UniProtQ60381|GLNK1_METJA Nitrogen regulatory protein GlnK1 (Gene Name=glnK1)

[Back to BioLiP]