Structure of PDB 7p50 Chain A

Receptor sequence
>7p50A (length=121) Species: 523845 (Methanothermococcus thermolithotrophicus DSM 2095) [Search protein sequence]
SHHHHHGSHMKKVEAIIRPERLDIVKNSLTDAGYVGMTVSEVKGRGIQGG
IVERYRGREYTVDLLPKIKIELVVKEEDVEKIIDIICENAKTGNQGDGKV
FIIPVEEVVRVRTKERGRGAI
3D structure
PDB7p50 The Oxoglutarate Binding Site and Regulatory Mechanism Are Conserved in Ammonium Transporter Inhibitors GlnKs from Methanococcales .
ChainA
Resolution1.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 AKG A G37 Q39 G41 I42 L56 K58 Q86 G87 G46 Q48 G50 I51 L65 K67 Q95 G96
BS02 ATP A I7 G35 R36 G37 I38 Q39 Q86 G87 G89 K90 F92 I16 G44 R45 G46 I47 Q48 Q95 G96 G98 K99 F101
BS03 ATP A G27 M28 T29 V64 R101 R103 G36 M37 T38 V73 R110 R112
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Dec 18 23:16:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7p50', asym_id = 'A', title = 'The Oxoglutarate Binding Site and Regulatory Mec...nsporter Inhibitors GlnKs from Methanococcales . '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7p50', asym_id='A', title='The Oxoglutarate Binding Site and Regulatory Mec...nsporter Inhibitors GlnKs from Methanococcales . ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006808,0030234', uniprot = '', pdbid = '7p50', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006808,0030234', uniprot='', pdbid='7p50', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>