Structure of PDB 7p0p Chain A

Receptor sequence
>7p0pA (length=65) Species: 9606 (Homo sapiens) [Search protein sequence]
SLINLKIQKENPKVVNEINIEDLSLTKAAYCRCWRSKTFPACDGSHNKHN
ELTGDNVGPLILKKK
3D structure
PDB7p0p An anti-diabetic drug targets NEET (CISD) proteins through destabilization of their [2Fe-2S] clusters.
ChainA
Resolution1.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES A C99 R100 C101 S104 C110 D111 G112 S113 H114 P127 C31 R32 C33 S36 C42 D43 G44 S45 H46 P59
BS02 49I A K81 V83 K13 V15
Gene Ontology
Molecular Function
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0010506 regulation of autophagy
Cellular Component
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p0p, PDBe:7p0p, PDBj:7p0p
PDBsum7p0p
PubMed35538231
UniProtQ8N5K1|CISD2_HUMAN CDGSH iron-sulfur domain-containing protein 2 (Gene Name=CISD2)

[Back to BioLiP]