Structure of PDB 7oz1 Chain A

Receptor sequence

>7oz1A (length=544) Species: 9606 (Homo sapiens)

AVNIEFRDLSYSVPEGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI
LAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV
SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALE
LVNNPPVMFFDQPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKL
FELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVAS
GEYGDQNSRLVRAVRSASCLTQFCILFKRTFLSIMRDSVLTHLRITSHIG
IGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMG
VFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAV
RFVLFAALGTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGF
FVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCHFQ
KSEAILRELDVENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRA

3D structure

• PDB: 7oz1 Structure of the Human Cholesterol Transporter ABCG1.
• Chain: A
• Resolution: 4.0 Å

Enzymatic activity

• Enzyme Commision number: 7.6.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	E88 K98 L100 G123 K124 S125 Q242	E15 K18 L20 G43 K44 S45 Q162
BS02	Y01	A	F455 Q551 T554 F555 P558 V559 A561	F335 Q431 T434 F435 P438 V439 A441
BS03	Y01	A	Y586 I645 F646 S649 L650 I653	Y466 I525 F526 S529 L530 I533
BS04	Y01	A	W583 Y586 I587	W463 Y466 I467
BS05	Y01	A	Y487 F647 R651 L652 Y655	Y367 F527 R531 L532 Y535
BS06	Y01	A	F455 Q551 P558	F335 Q431 P438

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0005543 phospholipid binding
• GO:0015485 cholesterol binding
• GO:0016887 ATP hydrolysis activity
• GO:0019534 toxin transmembrane transporter activity
• GO:0034041 ABC-type sterol transporter activity
• GO:0042803 protein homodimerization activity
• GO:0043531 ADP binding
• GO:0046982 protein heterodimerization activity
• GO:0046983 protein dimerization activity
• GO:0090554 phosphatidylcholine floppase activity
• GO:0120020 cholesterol transfer activity
• GO:0140328 floppase activity
• GO:0140359 ABC-type transporter activity

Biological Process

• GO:0006869 lipid transport
• GO:0008203 cholesterol metabolic process
• GO:0010745 negative regulation of macrophage derived foam cell differentiation
• GO:0010875 positive regulation of cholesterol efflux
• GO:0010887 negative regulation of cholesterol storage
• GO:0010888 negative regulation of lipid storage
• GO:0030301 cholesterol transport
• GO:0032367 intracellular cholesterol transport
• GO:0033344 cholesterol efflux
• GO:0033700 phospholipid efflux
• GO:0033993 response to lipid
• GO:0034204 lipid translocation
• GO:0034374 low-density lipoprotein particle remodeling
• GO:0034375 high-density lipoprotein particle remodeling
• GO:0034436 glycoprotein transport
• GO:0042632 cholesterol homeostasis
• GO:0042987 amyloid precursor protein catabolic process
• GO:0043691 reverse cholesterol transport
• GO:0045542 positive regulation of cholesterol biosynthetic process
• GO:0050714 positive regulation of protein secretion
• GO:0055085 transmembrane transport
• GO:0055091 phospholipid homeostasis
• GO:0071403 cellular response to high density lipoprotein particle stimulus
• GO:0090181 regulation of cholesterol metabolic process
• GO:1902004 positive regulation of amyloid-beta formation

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005739 mitochondrion
• GO:0005768 endosome
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0005794 Golgi apparatus
• GO:0005886 plasma membrane
• GO:0009897 external side of plasma membrane
• GO:0016020 membrane
• GO:0055037 recycling endosome

External links

• PDB: RCSB:7oz1, PDBe:7oz1, PDBj:7oz1
• PDBsum: 7oz1
• PubMed: 34461069
• UniProt: P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 (Gene Name=ABCG1)