Structure of PDB 7oui Chain A

Receptor sequence

>7ouiA (length=326) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

ESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGG
PYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQ
GRVINTWADIINRANLGMEVMHERNA

3D structure

PDB

7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.

Chain

Resolution

2.79 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	R27 L72 N76 I77 F239	R17 L62 N66 I67 F229
BS02	CLA	A	F119 P150 A153 V157 M183 F186 I192 H198 G201 V202 F206 T286 I290	F109 P140 A143 V147 M173 F176 I182 H188 G191 V192 F196 T276 I280
BS03	CLA	A	T45 M172 I176 T179 F180 M183	T35 M162 I166 T169 F170 M173
BS04	PHO	A	T45 F48 I115 F119 Y126 E130 A146 Y147 P150 L174 P279 I283	T35 F38 I105 F109 Y116 E120 A136 Y137 P140 L164 P269 I273
BS05	PHO	A	L210 M214	L200 M204
BS06	CLA	A	L36 T40 F93 P95 I96 W97 L114 H118	L26 T30 F83 P85 I86 W87 L104 H108
BS07	AJP	A	M199 F300	M189 F290
BS08	BCT	A	H215 Y246 H272	H205 Y236 H262
BS09	FE2	A	H215 H272	H205 H262
BS10	CA	A	Q165 D170	Q155 D160
BS11	CLA	A	F33 L120 L121 W131	F23 L110 L111 W121
BS12	CLA	A	M199 V202 F206 G207	M189 V192 F196 G197
BS13	AJP	A	I50 L72	I40 L62

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction
GO:0051238	sequestering of metal ion

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009536	plastid
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum	7oui
PubMed	34330992
UniProt	P83755\|PSBA_ARATH Photosystem II protein D1 (Gene Name=psbA)

[Back to BioLiP]