Structure of PDB 7or2 Chain A

Receptor sequence

>7or2A (length=337) Species: 208964 (Pseudomonas aeruginosa PAO1)

LELQEHCSLKPYNTFGIDVRARLLAHARDEADVREALALARERGLPLLVI
GGGSNLLLTRDVEALVLRMASQGRRIVSDAADSVLVEAEAGEAWDPFVQW
SLERGLAGLENLSLIPGTVGAAPMQNIGAYGVELKDVFDSLTALDRQDGT
LREFDRQACRFGYRDSLFKQEPDRWLILRVRLRLTRRERLHLDYGPVRQR
LEEEGIASPTARDVSRVICAIRREKLPDPAVLGNAGSFFKNPLVDATQAE
RLRQAFPDLVGYPQADGRLKLAAGWLIDKGGWKGFRDGPVGVHAQQALVL
VNHGGATGAQVRALAERIQEDVRRRFGVELEPEPNLY

3D structure

• PDB: 7or2 Discovery of Novel Inhibitors of Uridine Diphosphate- N -Acetylenolpyruvylglucosamine Reductase (MurB) from Pseudomonas aeruginosa , an Opportunistic Infectious Agent Causing Death in Cystic Fibrosis Patients.
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	V51 G53 G54 G55 S56 N57 I117 P118 G119 T120 A123 M126 I129 G130 R166 L178 I179 R224 N236 A237 G238 E335 N337	V49 G51 G52 G53 S54 N55 I115 P116 G117 T118 A121 M124 I127 G128 R164 L176 I177 R222 N234 A235 G236 E333 N335

Gene Ontology

Molecular Function

• GO:0008762 UDP-N-acetylmuramate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0051301 cell division
• GO:0071555 cell wall organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7or2, PDBe:7or2, PDBj:7or2
• PDBsum: 7or2
• PubMed: 35080396
• UniProt: Q9HZM7|MURB_PSEAE UDP-N-acetylenolpyruvoylglucosamine reductase (Gene Name=murB)